PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00102077001
Common NameGSBRNA2T00102077001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 594aa    MW: 66801 Da    PI: 4.7284
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00102077001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like44.53.3e-14206254554
              G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                          +Wt + H +F+ a++ L G++k  Pk+ile+m+   L+  +v S LQkY+
  GSBRNA2T00102077001 206 VWTRDRHMKFLAAISFL-GEKKSRPKAILEIMNDSNLSQRQVGSYLQKYK 254
                          6****************.9******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011017.62519131IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.1E-720150No hitNo description
SuperFamilySSF521722.65E-820165IPR011006CheY-like superfamily
PfamPF000721.6E-520126IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466891.22E-9204256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-14206257IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-13206254IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MAENMVNLTK NIIPESTGVI LLIDHDAASV ASLIPMLKQR SHKDVMTVNG ASEAILVIEK  60
QKDIGLVIAN VELSDSNDFL TAMHHKEIPL ILIGTEIHIK ETSDLLTKRA CYCLKKPISE  120
NDIDNMFQLV LPNKKQEWEK INVAEKRENI VEERMKQMKA FRDHIKRQGT SQSSLLGRRP  180
LNKTFTFSQM YQKGKSIVDV ETRMNVWTRD RHMKFLAAIS FLGEKKSRPK AILEIMNDSN  240
LSQRQVGSYL QKYKFQVEII NKTLTRNEWK STDKTYEYPS DYVYPFKASN LAKNFIESNS  300
MWCSLRKKKS SSLSTVQYSF KRSAAEKKDK MPKFHIGEAL GLHHTLSGPS VGASNLDAFQ  360
KESAEICISQ SNPNPSQPSS YVLETNKNPL DMNQMGRVSF GENHGLSQDM VFNGTKSNHL  420
GLVSGETSHI ETPLETDINQ MDWDWFFSDE AYAILDEDLT VSETNINQVG LVPGETSFAA  480
LDNVAPPENN TNEIGLVPNQ EGNGDIPIED LISFDTDIIN DMDDLDAWLE NYDSFQGDVP  540
LPAICNDHDL AFTSTTSQHQ NIEAANPSEG TEGGNHMDDD SDENLDWIDD IFT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00102077001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894890.0AC189489.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084K02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652284.10.0PREDICTED: putative two-component response regulator-like APRR6
TrEMBLA0A078E2H30.0A0A078E2H3_BRANA; BnaA07g26910D protein
STRINGBra004289.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.11e-112pseudo-response regulator 6
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]